PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang07g01620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family ARR-B
Protein Properties Length: 666aa    MW: 74702.5 Da    PI: 6.0424
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang07g01620.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like84.98e-27443494456
         G2-like   4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                     ++WtpeLH++Fv+aveqL G+++A+P++ile+mkv+gLt+++v+SHLQkYR++
  Vang07g01620.1 443 VDWTPELHKNFVKAVEQL-GIDQAIPSRILEIMKVEGLTRHNVASHLQKYRMH 494
                     58****************.********************************96 PP

2Response_reg25.18.6e-1013621925109
                     EEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHHH CS
    Response_reg  25 evaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelvk 109
                     +v ++ d  eal  +  +   +++ ++ ++ +  + G+++l++   + ++lp i+++ ++  +++ +++ +Ga +flsKp ++++l +
  Vang07g01620.1 136 KVSTFYDENEALSAVSSSPedFHVAIVEVSTSSsLGGFKFLEN---A-KDLPTIMISKNQCLNTTMKCIALGAVEFLSKPLSEDKLKN 219
                     899************6666449999999888887788887764...3.4799********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521721.42E-1092229IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23005.0E-1492245No hitNo description
PROSITE profilePS5011017.24495225IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.90E-697224No hitNo description
PfamPF000724.2E-6136219IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5129410.597435496IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-25443497IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-24443494IPR006447Myb domain, plants
PfamPF002491.1E-6444492IPR001005SANT/Myb domain
SuperFamilySSF466891.34E-16444496IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
LTLDVLLAFH ILKALYHVSK FKFLWTFCFT FFFAFLSSVQ QIQACDLTDL AEGILCSKST  60
LICYISWELS DDAKPAMVCT ANDLQGWKDF PKGLRVLVLD GDRSSAAEIG EQLEAMDYHG  120
YMPLSVLKAG SGPNSKVSTF YDENEALSAV SSSPEDFHVA IVEVSTSSSL GGFKFLENAK  180
DLPTIMISKN QCLNTTMKCI ALGAVEFLSK PLSEDKLKNI WQHVVHKAFN SRANGLSESL  240
KPVKESVESV LQFQTGNEQD KTHKRTMSID LENVSRFGDN DNEQSVCDKY PAPSTPQLKH  300
GTRLLDDGDC HEQTNFSTEK ESGEHDGECK SVETSCENLN AESTPQPTEP EETLIKEEED  360
FANGSKGERA VSLNLQNEKF LSNADGHTSP KKMGVFNDSC EIKANRKKMK DKIVELGSVT  420
ADLHFNYILS MNCFSPETLG FVVDWTPELH KNFVKAVEQL GIDQAIPSRI LEIMKVEGLT  480
RHNVASHLQK YRMHRRQSAP GEEDRKWHNQ RDVMQRNFYL QRPIMAYPPY HSNQTISPAP  540
IYPMWGQPGS QTAAVQIWGP PAYPLWHPTE NWNWKPYPGM HVDAWGCPLF PPPQAPGFHF  600
NQNIPGLHTP KPVDYRFSMP RSSFEHHPVA TTVVDMAGSL VIQHHDAAQM DYALILFIPL  660
AKTQN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520918.10.0PREDICTED: two-component response regulator-like APRR2 isoform X1
TrEMBLA0A0L9UQR60.0A0A0L9UQR6_PHAAN; Uncharacterized protein
STRINGGLYMA11G04441.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.51e-117ARR-B family protein